General Information

  • ID:  hor002257
  • Uniprot ID:  O02036
  • Protein name:  Leucokinin-2
  • Gene name:  AAEL010172
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Kinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NPFHAWG
  • Length:  7
  • Propeptide:  MAMLLQVALPLLAAVSWGWELNENDDSLAKIIEGCEWTSRQNVISEILLDRYRKYAMYNFFLLDDVCAVHEWNKNLKEPEFSENNEAEDKSPTSAQNTQEHIPGNNFPPPAASNPPVNSSCAKSAKDFFICLSNQLGDPTLNAMLLDNLEVACDPRFSPVSAIQKRNSKYVSKQKFYSWGGKRNNPNVFYPWGGKRNTGRVHRQPKVVIRNPFHAWGGKRNQKDDNVF
  • Signal peptide:  MAMLLQVALPLLAAVSWG
  • Modification:  T7 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates both fluid secretion by the Malpighian tubules and hindgut contractions. Depolarize the transepithelial voltage of the Malpighian tubules in concentrations of less than 10(-9) M and increase the frequency of hindgut contractions at concentrations above 10(-8) M.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O02036-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002257_AF2.pdbhor002257_ESM.pdb

Physical Information

Mass: 93510 Formula: C40H49N11O9
Absent amino acids: CDEIKLMQRSTVY Common amino acids: AFGHNPW
pI: 7.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -71.43 Boman Index: -324
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 14.29
Instability Index: 1715.71 Extinction Coefficient cystines: 5500
Absorbance 280nm: 916.67

Literature

  • PubMed ID:  8048942
  • Title:  Isolation and Identification of Three Leucokinins From the Mosquito Aedes Aegypti